(data stored in ACNUC7421 zone)

EMBL: CP002299.PE328

CP002299.PE328       Location/Qualifiers
FT   CDS             412045..412650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78416"
FT                   /db_xref="GOA:E3J7E3"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6563"
FT                   /protein_id="ADP78416.1"
FT                   /translation="MAVFGHGDRRLGRDASLGELVALATKDVSLLVRQEIELAKAEVGR
FT                   QVASAAVGIGLLGVAAGLVLGALLALMIFFGELFAWLGLERFWAFLLTAGLLFVLAGVL
FT                   ALLAALRLRKLQPPRRTVASVREDVALLRHATGGAGDARGGSPAKSGPPTGQTTPVGAE
FT                   TRSARPVVAPIPQSRDAAPPAGRRPAEFDRPGAVEPRA"
     MAVFGHGDRR LGRDASLGEL VALATKDVSL LVRQEIELAK AEVGRQVASA AVGIGLLGVA        60
     AGLVLGALLA LMIFFGELFA WLGLERFWAF LLTAGLLFVL AGVLALLAAL RLRKLQPPRR       120
     TVASVREDVA LLRHATGGAG DARGGSPAKS GPPTGQTTPV GAETRSARPV VAPIPQSRDA       180
     APPAGRRPAE FDRPGAVEPR A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page