(data stored in ACNUC7421 zone)

EMBL: CP002299.PE329

CP002299.PE329       Location/Qualifiers
FT   CDS             412775..413698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0331"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: fal:FRAAL6562
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78417"
FT                   /db_xref="GOA:E3J7E4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78417.1"
FT                   /translation="MDEAAPDPASVLIDGPWRHRDVSANGTRLHVAELGQGPLVLLLHG
FT                   FPQFWWAWRHQLVALAAAGYRVVAPDLRGYGASDKPPRGYDAFTLADDVAGLIRALGER
FT                   DAVLVGHDWGGLASWTAAAVWPRQVRRIAVLGMPHPLRIRHEYAVDPRGQGLAGAHLFG
FT                   FQLPWRPERQLVADDAARVGGYLRAWGGPGFPSDDEDRRYRAAMRIPGVAHSSLEYHRW
FT                   VFRSLFRPDGARFAQALRRAVNCPVLHLHGGADPFLLPDTAQGSGRFVSGPYAWQLLPG
FT                   VGHFLPEEAPDQVSDVLLRWLDAPTP"
     MDEAAPDPAS VLIDGPWRHR DVSANGTRLH VAELGQGPLV LLLHGFPQFW WAWRHQLVAL        60
     AAAGYRVVAP DLRGYGASDK PPRGYDAFTL ADDVAGLIRA LGERDAVLVG HDWGGLASWT       120
     AAAVWPRQVR RIAVLGMPHP LRIRHEYAVD PRGQGLAGAH LFGFQLPWRP ERQLVADDAA       180
     RVGGYLRAWG GPGFPSDDED RRYRAAMRIP GVAHSSLEYH RWVFRSLFRP DGARFAQALR       240
     RAVNCPVLHL HGGADPFLLP DTAQGSGRFV SGPYAWQLLP GVGHFLPEEA PDQVSDVLLR       300
     WLDAPTP                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page