(data stored in ACNUC7421 zone)

EMBL: CP002299.PE331

CP002299.PE331       Location/Qualifiers
FT   CDS             complement(414922..415302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0333"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   fal:FRAAL6560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78419"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E6"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ADP78419.1"
FT                   /translation="MAIAAALALGVTAAGCAAKEPVAPKVVAIETPTMSGDVQVFQVTG
FT                   LADLRFDVSTLEARPGKIRVDFTVARGSASHDFVIPKIPAARTDIIGAGSTQSVTFAVT
FT                   EPGDYPVICTLHPSMSATLHVG"
     MAIAAALALG VTAAGCAAKE PVAPKVVAIE TPTMSGDVQV FQVTGLADLR FDVSTLEARP        60
     GKIRVDFTVA RGSASHDFVI PKIPAARTDI IGAGSTQSVT FAVTEPGDYP VICTLHPSMS       120
     ATLHVG                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page