(data stored in ACNUC7421 zone)

EMBL: CP002299.PE337

CP002299.PE337       Location/Qualifiers
FT   CDS             complement(422576..423424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0339"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   fal:FRAAL6554 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78425"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F2"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADP78425.1"
FT                   /translation="MTAGSQPSPRPAGPPPPASAPRQVNPLAAVVLAPNPGPMTLEGTN
FT                   SWVLRAPGHDGCVVIDPGPDYPEHLAAIAAAGPVTTILLTHGHPDHSEGAAALHELTGA
FT                   PVRALDPTHRLGSEGLVEGDVVAAAGIELRVLATPGHSADSLSFLLFGDVPDGDEAVAV
FT                   LTGDTILGRGTTVVAHPDGRLADYLASLHRLADLPTGLGVLPGHGPELADARAAATYYL
FT                   AHRAERLDQVRAALTAAGVGPAQASPRAVVERVYADVDRVLWPAAELSVRAQLEYLRDN
FT                   A"
     MTAGSQPSPR PAGPPPPASA PRQVNPLAAV VLAPNPGPMT LEGTNSWVLR APGHDGCVVI        60
     DPGPDYPEHL AAIAAAGPVT TILLTHGHPD HSEGAAALHE LTGAPVRALD PTHRLGSEGL       120
     VEGDVVAAAG IELRVLATPG HSADSLSFLL FGDVPDGDEA VAVLTGDTIL GRGTTVVAHP       180
     DGRLADYLAS LHRLADLPTG LGVLPGHGPE LADARAAATY YLAHRAERLD QVRAALTAAG       240
     VGPAQASPRA VVERVYADVD RVLWPAAELS VRAQLEYLRD NA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page