(data stored in ACNUC7421 zone)

EMBL: CP002299.PE34

CP002299.PE34        Location/Qualifiers
FT   CDS             40938..41861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0034"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL6834 putrescine
FT                   ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78122"
FT                   /db_xref="GOA:E3J284"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J284"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78122.1"
FT                   /translation="MTETVAAAPETGAAGGHGKKPKHWRSPWTPYLLSTPGGLYLAIFF
FT                   VVPMLVMLSVSLQTGNVTDGFAQTFNFGIYPHAISEYSTQLIRSFIYGGACTLLSIVLA
FT                   YPMAYWIAFHGGKRRATYLFLVLLPFLVSFIIRTVSWEFLLADDGVILGNLKHIGLLPD
FT                   GFRVMATSAAVIGGLTYNSFPFMLLPIYVALERMDPRLLEAAGDLYANKAGVFGRVVLP
FT                   LSMPGVFAGVLLTFVPATSDYVNASILGGTHNTMIGNIIQTAFLTNADYPLASALSFIL
FT                   MVILLVGILIYARVLGTRDVFEMATR"
     MTETVAAAPE TGAAGGHGKK PKHWRSPWTP YLLSTPGGLY LAIFFVVPML VMLSVSLQTG        60
     NVTDGFAQTF NFGIYPHAIS EYSTQLIRSF IYGGACTLLS IVLAYPMAYW IAFHGGKRRA       120
     TYLFLVLLPF LVSFIIRTVS WEFLLADDGV ILGNLKHIGL LPDGFRVMAT SAAVIGGLTY       180
     NSFPFMLLPI YVALERMDPR LLEAAGDLYA NKAGVFGRVV LPLSMPGVFA GVLLTFVPAT       240
     SDYVNASILG GTHNTMIGNI IQTAFLTNAD YPLASALSFI LMVILLVGIL IYARVLGTRD       300
     VFEMATR                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page