(data stored in ACNUC7421 zone)

EMBL: CP002299.PE345

CP002299.PE345       Location/Qualifiers
FT   CDS             complement(431414..431869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78433"
FT                   /db_xref="GOA:E3J7G0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6545"
FT                   /protein_id="ADP78433.1"
FT                   /translation="MNTLKERLRADLTTAMKARDELRTSTLRLAISAVKEAEVAGKSAH
FT                   ELTDDEVEKVLTREVRKRREAADAYAGAGRAEQAARERSEGEVLADYLPKQLGDDELAA
FT                   IVDKVLADGDFAGPKAIGPAMKAVQAIVAGRADGGKVAGLVKARLTA"
     MNTLKERLRA DLTTAMKARD ELRTSTLRLA ISAVKEAEVA GKSAHELTDD EVEKVLTREV        60
     RKRREAADAY AGAGRAEQAA RERSEGEVLA DYLPKQLGDD ELAAIVDKVL ADGDFAGPKA       120
     IGPAMKAVQA IVAGRADGGK VAGLVKARLT A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page