(data stored in ACNUC7421 zone)

EMBL: CP002299.PE347

CP002299.PE347       Location/Qualifiers
FT   CDS             433222..433833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0349"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   oan:Oant_0128 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78435"
FT                   /db_xref="GOA:E3J7G2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G2"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADP78435.1"
FT                   /translation="MSLAFLVTSLAIVATPGTGVVLTVAAGLRSGRRVAVVTALGCTLG
FT                   IVPHLAAAVTGTAALLRAGGLAFEGLKIAGVCYLLYMAWSTWRDQGILAVDESGPPVST
FT                   ARTIGNAVLANLLNPKLTLFFFAFLPQFVNQGGAGATTRMVALGGMFMAMTLVVFIGYG
FT                   LFASYLRRHLIDRPNAVRRLQRFFSLSYLGLGAKLATTHR"
     MSLAFLVTSL AIVATPGTGV VLTVAAGLRS GRRVAVVTAL GCTLGIVPHL AAAVTGTAAL        60
     LRAGGLAFEG LKIAGVCYLL YMAWSTWRDQ GILAVDESGP PVSTARTIGN AVLANLLNPK       120
     LTLFFFAFLP QFVNQGGAGA TTRMVALGGM FMAMTLVVFI GYGLFASYLR RHLIDRPNAV       180
     RRLQRFFSLS YLGLGAKLAT THR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page