(data stored in ACNUC7421 zone)

EMBL: CP002299.PE349

CP002299.PE349       Location/Qualifiers
FT   CDS             complement(435088..435825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0351"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: fal:FRAAL2982 putative sensory transduction
FT                   protein; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78437"
FT                   /db_xref="GOA:E3J7G4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78437.1"
FT                   /translation="MTITVLLVDDQPLLRMGFRMVIESQPDLRVVGEAGDGAAAAALAA
FT                   ELSPDVVVMDVRMPGVDGIEATRRIAAAGGVSRVLILTTFDLDQYVLAGLRAGASGFLL
FT                   KDVPPADLLTAIRTVAAGDAVVAPNVTRRLLDAFAHHLPDPDASADGGPDRPAGRVANR
FT                   RTAGTDRLDRLTDRERDVLGEVAAGLSNAEIAARLVLSEATVKTHVGRILAKLELRDRV
FT                   QAVVFAYETGLIRPSANPPRHDG"
     MTITVLLVDD QPLLRMGFRM VIESQPDLRV VGEAGDGAAA AALAAELSPD VVVMDVRMPG        60
     VDGIEATRRI AAAGGVSRVL ILTTFDLDQY VLAGLRAGAS GFLLKDVPPA DLLTAIRTVA       120
     AGDAVVAPNV TRRLLDAFAH HLPDPDASAD GGPDRPAGRV ANRRTAGTDR LDRLTDRERD       180
     VLGEVAAGLS NAEIAARLVL SEATVKTHVG RILAKLELRD RVQAVVFAYE TGLIRPSANP       240
     PRHDG                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page