(data stored in ACNUC7421 zone)

EMBL: CP002299.PE354

CP002299.PE354       Location/Qualifiers
FT   CDS             440605..441477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0356"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: fal:FRAAL1558 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78442"
FT                   /db_xref="GOA:E3J8J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8J9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78442.1"
FT                   /translation="MPLVGCIGQRGVVGGGVTEAGIRLTGVTRSYGDVLAVEGVDLAVP
FT                   RGRRLAVVGPSGCGKSTILGLMSGLDEPDQGVVDVLGATDQAARLARCAWMPQRDLLLP
FT                   WRSALANAAVSLENRGISRREARAVVRPLFARFGLAGFEEHRPRQLSGGMRQRVAFLRT
FT                   FVAGKEVLLLDEPFGALDAITRAEAQDWLRAALEAEPRTVVLVTHDVEEALLLGHEIVV
FT                   LTGRPGKVAASYAVDLPAAATRRELLATPEFIQLRDKVLAALEQRPSAPVAAVKSADGS
FT                   PNPVRRAEG"
     MPLVGCIGQR GVVGGGVTEA GIRLTGVTRS YGDVLAVEGV DLAVPRGRRL AVVGPSGCGK        60
     STILGLMSGL DEPDQGVVDV LGATDQAARL ARCAWMPQRD LLLPWRSALA NAAVSLENRG       120
     ISRREARAVV RPLFARFGLA GFEEHRPRQL SGGMRQRVAF LRTFVAGKEV LLLDEPFGAL       180
     DAITRAEAQD WLRAALEAEP RTVVLVTHDV EEALLLGHEI VVLTGRPGKV AASYAVDLPA       240
     AATRRELLAT PEFIQLRDKV LAALEQRPSA PVAAVKSADG SPNPVRRAEG                  290
//

If you have problems or comments...

PBIL Back to PBIL home page