(data stored in ACNUC7421 zone)

EMBL: CP002299.PE355

CP002299.PE355       Location/Qualifiers
FT   CDS             441481..442320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0357"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL1557 putative ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78443"
FT                   /db_xref="GOA:E3J8K0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78443.1"
FT                   /translation="MSSTAQAHAAARTGNRTAGRQGRLVRVFRRYGPAAVVLVAILAAW
FT                   ELATVVFGVEDYILPAPSAVVRALVDRWNGTLASATWVTLTEVLLGFAIAVAAGLVTAS
FT                   CLHFSRIARAALYPWLIGSQTVPVVVIAPVLAIIFGYTLTPKLILVALLCFFPIVVATL
FT                   DGLAAVEPDLVRLMRTLYGSRWAIFRRVELPAALPSMFTGLRLSAAYAATAAVFGEYSG
FT                   SSDGLGHVMRQAVPQLQSALVFAAIALLSAMSVALFVLVTVLERLLVGWAHEGKKVR"
     MSSTAQAHAA ARTGNRTAGR QGRLVRVFRR YGPAAVVLVA ILAAWELATV VFGVEDYILP        60
     APSAVVRALV DRWNGTLASA TWVTLTEVLL GFAIAVAAGL VTASCLHFSR IARAALYPWL       120
     IGSQTVPVVV IAPVLAIIFG YTLTPKLILV ALLCFFPIVV ATLDGLAAVE PDLVRLMRTL       180
     YGSRWAIFRR VELPAALPSM FTGLRLSAAY AATAAVFGEY SGSSDGLGHV MRQAVPQLQS       240
     ALVFAAIALL SAMSVALFVL VTVLERLLVG WAHEGKKVR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page