(data stored in ACNUC7421 zone)

EMBL: CP002299.PE356

CP002299.PE356       Location/Qualifiers
FT   CDS             442317..443351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0358"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: fal:FRAAL1556 putative ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78444"
FT                   /db_xref="GOA:E3J8K1"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1556"
FT                   /protein_id="ADP78444.1"
FT                   /translation="MRAHRSRLLTGLGAASALMAGVLVLTACGGGTKSSDAGGSAQTRR
FT                   TTVLLDWDPNPDHVALYSARAAGYFKAAGLDVTLQSPSDPSDPTKLVSTGKVDLGISYE
FT                   PETIIAGSQGLDVVSVGALVPTALTSVIATDKSRVHSIPDLAGARVATAGLATQDAFLK
FT                   TILAQNHVDAGSVKKVDVGQDLIAAMVTGNVDATLGGFRNVEAVQLEAQGLKPTVIPVT
FT                   AAGVPNYAELVVIAKASRLKSDPAYRQLVRDFLAALAKGNAAVLADPATAAATIAKVAQ
FT                   GYDPAVLPKMVDATVPLLRNAAGFGHEDPAAWQSFADWMSAQQLIDKPVKAADVVTNSY
FT                   LPAS"
     MRAHRSRLLT GLGAASALMA GVLVLTACGG GTKSSDAGGS AQTRRTTVLL DWDPNPDHVA        60
     LYSARAAGYF KAAGLDVTLQ SPSDPSDPTK LVSTGKVDLG ISYEPETIIA GSQGLDVVSV       120
     GALVPTALTS VIATDKSRVH SIPDLAGARV ATAGLATQDA FLKTILAQNH VDAGSVKKVD       180
     VGQDLIAAMV TGNVDATLGG FRNVEAVQLE AQGLKPTVIP VTAAGVPNYA ELVVIAKASR       240
     LKSDPAYRQL VRDFLAALAK GNAAVLADPA TAAATIAKVA QGYDPAVLPK MVDATVPLLR       300
     NAAGFGHEDP AAWQSFADWM SAQQLIDKPV KAADVVTNSY LPAS                        344
//

If you have problems or comments...

PBIL Back to PBIL home page