(data stored in ACNUC7421 zone)

EMBL: CP002299.PE357

CP002299.PE357       Location/Qualifiers
FT   CDS             complement(443373..443660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eta:ETA_29080 hypothetical protein YqjC"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78445"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K2"
FT                   /inference="similar to AA sequence:KEGG:ETA_29080"
FT                   /protein_id="ADP78445.1"
FT                   /translation="MRIRLVGASLLAVVAIAATATGCSQKAREVGRDAPVSSHDDKPAR
FT                   LINMPDGFSNVSAKCDGPNMVYVVYHSDSAYGSVAIAPNDPRCRTAGSTG"
     MRIRLVGASL LAVVAIAATA TGCSQKAREV GRDAPVSSHD DKPARLINMP DGFSNVSAKC        60
     DGPNMVYVVY HSDSAYGSVA IAPNDPRCRT AGSTG                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page