(data stored in ACNUC7421 zone)

EMBL: CP002299.PE360

CP002299.PE360       Location/Qualifiers
FT   CDS             complement(446966..447829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0362"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mmi:MMAR_0140
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78448"
FT                   /db_xref="GOA:E3J8K5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K5"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADP78448.1"
FT                   /translation="MAFPTGVPIIDTMIGFPQPGTSQYDFIRRQLKDAESKEFAFPAEY
FT                   MFKNVPHDLPTDDPVSVTLHEMDRFGVEKGLIGCAGESARVALKKFPDRFVASGNINDP
FT                   NDVMGTVRAIVRDHEEYGIRAVGAFPSGTFPQVAINDEKMYPAYAKCVELGIAVFCCAG
FT                   VPGPRLKFEPQRVELIDQVMFDFPDLVFVTRHGCEPWTDLAVKLLLKWPNLYYSTSAFT
FT                   PKYYPKAIVDFANTRGADKILYAGYFPMGLTLERIMTDMPTVPFRDHVWPKFLHENARK
FT                   VLKLDA"
     MAFPTGVPII DTMIGFPQPG TSQYDFIRRQ LKDAESKEFA FPAEYMFKNV PHDLPTDDPV        60
     SVTLHEMDRF GVEKGLIGCA GESARVALKK FPDRFVASGN INDPNDVMGT VRAIVRDHEE       120
     YGIRAVGAFP SGTFPQVAIN DEKMYPAYAK CVELGIAVFC CAGVPGPRLK FEPQRVELID       180
     QVMFDFPDLV FVTRHGCEPW TDLAVKLLLK WPNLYYSTSA FTPKYYPKAI VDFANTRGAD       240
     KILYAGYFPM GLTLERIMTD MPTVPFRDHV WPKFLHENAR KVLKLDA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page