(data stored in ACNUC7421 zone)

EMBL: CP002299.PE361

CP002299.PE361       Location/Qualifiers
FT   CDS             complement(448159..449565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0363"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; KEGG: fal:FRAAL6537
FT                   prolyl-tRNA synthetase; PFAM: Anticodon-binding domain
FT                   protein; tRNA synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78449"
FT                   /db_xref="GOA:E3J8K6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K6"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ADP78449.1"
FT                   /translation="MAVLTLRSDDFPRWYQDVIAKAELADNGPVRGSMVIRPYGYSLWE
FT                   RMQADVDARIKAAGAVNAYFPLFIPESYLRREAEHVEGFSPELAVVTHGGGKELEEPVV
FT                   VRPTSETVIGEYMAKWTQSYRDLPLLLNQWANVVRWELRPRLFLRTSEFLWQEGHTAHA
FT                   DGPDAAAYARRIALEVYQDFMVSVLAMPVFVGRKTRKERFAGAINTLTCEGMMGDGKAL
FT                   QMATSHELGQNFARAFDIDYLGADGARHLAWTTSWGSSTRMVGGLIMAHGDDAGLRVPP
FT                   RLAPTQVVVLPVRDDEKVVATATQIADALKAAGVRATLDARPGLSFGRRVTDWELKGAP
FT                   VRVEVGPRDLAVGNVTLARRDTGEKITVPLAEAAARVPALLDDVQAGLYQQALALRDSR
FT                   TADVTSLADAIEAAATGFARLPWRLVGDEGEARLAAESLTVRCIQNADGTLPTGTDDTD
FT                   DLVCLVARAY"
     MAVLTLRSDD FPRWYQDVIA KAELADNGPV RGSMVIRPYG YSLWERMQAD VDARIKAAGA        60
     VNAYFPLFIP ESYLRREAEH VEGFSPELAV VTHGGGKELE EPVVVRPTSE TVIGEYMAKW       120
     TQSYRDLPLL LNQWANVVRW ELRPRLFLRT SEFLWQEGHT AHADGPDAAA YARRIALEVY       180
     QDFMVSVLAM PVFVGRKTRK ERFAGAINTL TCEGMMGDGK ALQMATSHEL GQNFARAFDI       240
     DYLGADGARH LAWTTSWGSS TRMVGGLIMA HGDDAGLRVP PRLAPTQVVV LPVRDDEKVV       300
     ATATQIADAL KAAGVRATLD ARPGLSFGRR VTDWELKGAP VRVEVGPRDL AVGNVTLARR       360
     DTGEKITVPL AEAAARVPAL LDDVQAGLYQ QALALRDSRT ADVTSLADAI EAAATGFARL       420
     PWRLVGDEGE ARLAAESLTV RCIQNADGTL PTGTDDTDDL VCLVARAY                    468
//

If you have problems or comments...

PBIL Back to PBIL home page