(data stored in ACNUC7421 zone)

EMBL: CP002299.PE365

CP002299.PE365       Location/Qualifiers
FT   CDS             453044..454111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0367"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="KEGG: fal:FRAAL6533 phosphate ABC transporter
FT                   permease; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstA; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78453"
FT                   /db_xref="GOA:E3J8L0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L0"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ADP78453.1"
FT                   /translation="MTTATAEAPAGAPSDDHLHLKGNQLPAYALPAVAAGAVAVALVLY
FT                   FATSIQGKIQTGLIAILLYGIGQTIASSLVEGGRRAVDRFVRTIIFGTLLLALIPLVAV
FT                   LVQVLVKGASRLDGDFLTHSMAGISARDAGGGAYAALIGTLEQIGLASLISIPFGVLVA
FT                   VYLVEYGRRNRLSRTISFFVDVLTGLPSIVAGLFIFAFWILLLHQHQTGFAGSLALVIL
FT                   MIPTVVRSTEEMLKLVPNELREASFALGIERWRTIMKVVIPTALPGIVTGVMLAISRVA
FT                   GETAPLLLTIFGNDYINSNPFVGHQSSLPIFIFTEATKPQASAIARAWAGALTLIILIM
FT                   LLNLIARLVSRRAKV"
     MTTATAEAPA GAPSDDHLHL KGNQLPAYAL PAVAAGAVAV ALVLYFATSI QGKIQTGLIA        60
     ILLYGIGQTI ASSLVEGGRR AVDRFVRTII FGTLLLALIP LVAVLVQVLV KGASRLDGDF       120
     LTHSMAGISA RDAGGGAYAA LIGTLEQIGL ASLISIPFGV LVAVYLVEYG RRNRLSRTIS       180
     FFVDVLTGLP SIVAGLFIFA FWILLLHQHQ TGFAGSLALV ILMIPTVVRS TEEMLKLVPN       240
     ELREASFALG IERWRTIMKV VIPTALPGIV TGVMLAISRV AGETAPLLLT IFGNDYINSN       300
     PFVGHQSSLP IFIFTEATKP QASAIARAWA GALTLIILIM LLNLIARLVS RRAKV            355
//

If you have problems or comments...

PBIL Back to PBIL home page