(data stored in ACNUC7421 zone)

EMBL: CP002299.PE369

CP002299.PE369       Location/Qualifiers
FT   CDS             456430..457857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L4"
FT                   /inference="similar to AA sequence:KEGG:Sros_0029"
FT                   /protein_id="ADP78457.1"
FT                   /translation="MLATQLADLLAATPAGVADALAVVDGFDDTLVTGLGRLGADQHAA
FT                   VFALADVLAASPLGPVAREAAEKLATGSVSDDVLATLAGARAAVLGAVHDALLGAVDLT
FT                   VGRERSAWDEGMGSAGATAGEAALGGCRSWLRELAIVGWRGAEDELVSSSAQAREAALA
FT                   VPPLRRLAVLLDGLAAELLAAGPVGVRGRLPVRRWADLWTRGVLLARHGAWAADGSAGV
FT                   STGRLLPLGAEVAEHGTAVRLVVHAVLETAGERPRLMRTAVTAAKVDTIVGPAVWRLLE
FT                   TYPVLVGALVERRAVEFSELVLLSTGDLVWREDAARLAEAADPFVTARVLPAGALAPPV
FT                   APLDRHPVRICEPVLLEGYTATLADDGQTLTFDLGGSVLGVEVEPAAADPAVSLGPLAP
FT                   AVLAGSSACLGLLRWDEGRWLLRPLGVQAVVKKKPLVAHVGDWARGAPDPRIAKARAKN
FT                   EDAVPVLRERAGRLLRG"
     MLATQLADLL AATPAGVADA LAVVDGFDDT LVTGLGRLGA DQHAAVFALA DVLAASPLGP        60
     VAREAAEKLA TGSVSDDVLA TLAGARAAVL GAVHDALLGA VDLTVGRERS AWDEGMGSAG       120
     ATAGEAALGG CRSWLRELAI VGWRGAEDEL VSSSAQAREA ALAVPPLRRL AVLLDGLAAE       180
     LLAAGPVGVR GRLPVRRWAD LWTRGVLLAR HGAWAADGSA GVSTGRLLPL GAEVAEHGTA       240
     VRLVVHAVLE TAGERPRLMR TAVTAAKVDT IVGPAVWRLL ETYPVLVGAL VERRAVEFSE       300
     LVLLSTGDLV WREDAARLAE AADPFVTARV LPAGALAPPV APLDRHPVRI CEPVLLEGYT       360
     ATLADDGQTL TFDLGGSVLG VEVEPAAADP AVSLGPLAPA VLAGSSACLG LLRWDEGRWL       420
     LRPLGVQAVV KKKPLVAHVG DWARGAPDPR IAKARAKNED AVPVLRERAG RLLRG            475
//

If you have problems or comments...

PBIL Back to PBIL home page