(data stored in ACNUC7421 zone)

EMBL: CP002299.PE370

CP002299.PE370       Location/Qualifiers
FT   CDS             457854..459227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0372"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="KEGG: stp:Strop_2018 VWA containing CoxE family
FT                   protein; PFAM: VWA containing CoxE family protein; SMART:
FT                   von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78458"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L5"
FT                   /inference="protein motif:PFAM:PF05762"
FT                   /protein_id="ADP78458.1"
FT                   /translation="MSIPSVSSGPAASAGPAGSAEPELDPAASENRRQVLYWRLLARIF
FT                   APDEQPSLEAASLAIVEDLDLPAALLDPTVSIDNVVQRFPALAPEIDGLLAAPAADLPA
FT                   GSVGAAEVRTAAVMAKLLLNTFATGSGGVTAGQLADWQADAGWLRRTLGPDVGDGPGGP
FT                   GAVLGEIEADLVSRMHLREVLANPTLARRLTPSMSLIEQLLRDKDNLSGVALANAKALI
FT                   RRFVDEVAEVLRTQVEQTSAGTLDRSVPPKRVFRNLDLDRTIWKNLPNWSPEDQRLYVD
FT                   RLYYRQTARRTTPAKMIVVVDQSGSMVDSMVNCTILASIFAGLPRVDVHLIAYDTRALD
FT                   LTPWVNDPFEVLLRTKLGGGNDGPVAMEMARPKISDPRNTVMVWISDFYEFDRSQPLFE
FT                   AIESLHRGGVRFIPVGSVNSSGRGSVNPWFRERFKDLGTPVISGHIRKLVAELKNFVA"
     MSIPSVSSGP AASAGPAGSA EPELDPAASE NRRQVLYWRL LARIFAPDEQ PSLEAASLAI        60
     VEDLDLPAAL LDPTVSIDNV VQRFPALAPE IDGLLAAPAA DLPAGSVGAA EVRTAAVMAK       120
     LLLNTFATGS GGVTAGQLAD WQADAGWLRR TLGPDVGDGP GGPGAVLGEI EADLVSRMHL       180
     REVLANPTLA RRLTPSMSLI EQLLRDKDNL SGVALANAKA LIRRFVDEVA EVLRTQVEQT       240
     SAGTLDRSVP PKRVFRNLDL DRTIWKNLPN WSPEDQRLYV DRLYYRQTAR RTTPAKMIVV       300
     VDQSGSMVDS MVNCTILASI FAGLPRVDVH LIAYDTRALD LTPWVNDPFE VLLRTKLGGG       360
     NDGPVAMEMA RPKISDPRNT VMVWISDFYE FDRSQPLFEA IESLHRGGVR FIPVGSVNSS       420
     GRGSVNPWFR ERFKDLGTPV ISGHIRKLVA ELKNFVA                                457
//

If you have problems or comments...

PBIL Back to PBIL home page