(data stored in ACNUC7421 zone)

EMBL: CP002299.PE379

CP002299.PE379       Location/Qualifiers
FT   CDS             471879..472397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0381"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: fal:FRAAL6523 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78467"
FT                   /db_xref="GOA:E3J8M4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M4"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADP78467.1"
FT                   /translation="MAAGVTPATAAAIALPRVGVGVDVHPFEQGRPCWVACLQWDGETG
FT                   LAGHSDGDVAAHAACDALLIASGLGDLGKVFGTDRPEWSGASGAALLGETARLLAEDGW
FT                   TIGNVAVQVVGNRPRMAKRRDEAAAAMATALGGAVVSVSATTTDGLGLTGRGEGLAAIA
FT                   TALVARLAG"
     MAAGVTPATA AAIALPRVGV GVDVHPFEQG RPCWVACLQW DGETGLAGHS DGDVAAHAAC        60
     DALLIASGLG DLGKVFGTDR PEWSGASGAA LLGETARLLA EDGWTIGNVA VQVVGNRPRM       120
     AKRRDEAAAA MATALGGAVV SVSATTTDGL GLTGRGEGLA AIATALVARL AG               172
//

If you have problems or comments...

PBIL Back to PBIL home page