(data stored in ACNUC7421 zone)

EMBL: CP002299.PE38

CP002299.PE38        Location/Qualifiers
FT   CDS             43722..44060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0038"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   fal:FRAAL0032 regulatory protein (P-II) for nitrogen
FT                   assimilation by glutamine synthetase (ATase)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78126"
FT                   /db_xref="GOA:E3J288"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E3J288"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADP78126.1"
FT                   /translation="MKLVTAILRPHRVADVRAALTTFGIHGMTISQASGYGMEVWRTSS
FT                   YRGRRFHDESVSNVRMEVVVDDADAEDIVNVILSSAASTASGAGKIWITPVVSLTRVRT
FT                   GERGMDAI"
     MKLVTAILRP HRVADVRAAL TTFGIHGMTI SQASGYGMEV WRTSSYRGRR FHDESVSNVR        60
     MEVVVDDADA EDIVNVILSS AASTASGAGK IWITPVVSLT RVRTGERGMD AI               112
//

If you have problems or comments...

PBIL Back to PBIL home page