(data stored in ACNUC7421 zone)

EMBL: CP002299.PE380

CP002299.PE380       Location/Qualifiers
FT   CDS             472575..472967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0382"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: fal:FRAAL6522 hypothetical protein; TIGRFAM:
FT                   putative F420-dependent enzyme; PFAM: pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78468"
FT                   /db_xref="GOA:E3J8M5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M5"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADP78468.1"
FT                   /translation="MGERLPEKVRTLADAPTYVTLATLQSDGSPRLTVLWIERDGDDLL
FT                   LSTVRGRAKERDIDRDPRVALMFLDQHDPYSYVEIRGTATLTEEGGRDLIDRLAVKYTG
FT                   EPYKWDGPDAIRVVIRISPTRVLTTG"
     MGERLPEKVR TLADAPTYVT LATLQSDGSP RLTVLWIERD GDDLLLSTVR GRAKERDIDR        60
     DPRVALMFLD QHDPYSYVEI RGTATLTEEG GRDLIDRLAV KYTGEPYKWD GPDAIRVVIR       120
     ISPTRVLTTG                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page