(data stored in ACNUC7421 zone)

EMBL: CP002299.PE381

CP002299.PE381       Location/Qualifiers
FT   CDS             473179..474699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0383"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="SMART: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; KEGG: fal:FRAAL6521
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78469"
FT                   /db_xref="GOA:E3J8M6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M6"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADP78469.1"
FT                   /translation="MSLHLYDTRTRRVRPFEPLRPGHVGVYVCGPTVQSAPHVGHLRSA
FT                   VAFDLLRRWLLESGYAVTYVQNVTDIDDKIIVNADREGVSVWELATRETRSFDDAYRAV
FT                   GILPPTIQPRATGHIPEMFALIGELMAAGYAYEGDGSVWFRVGRFGDYGALSNQRPDAM
FT                   QASAEVEAGKEDPRDFALWKAARPGEPAWDSPWGSGRPGWHLECSAMAGKYLGDVFDIH
FT                   GGGLDLVFPHHENERAQTVCASAARAHDGSGEPEMARYWMHVGLLTTGGTKMSKSLGNS
FT                   FFVTDALAQVRPQVLRYHLLSAHYRSSLEYSPDALAESAAGYGRVETFVRNALDILGSP
FT                   EEAASLAAEASPAAAPRPAKSRGKGRPQGRAAAGPAGTASPAAAWAAFSAALDDDLGVS
FT                   RALAALFGAVAEGNLVLSKTHRGELAGWLVVVRRMLTVLGLDPVKQWPAAGGQVRAALD
FT                   GVMEIVRDLRSSARARLDYAEADSIRDRLRDAGIIVDDTGEGQRWHLA"
     MSLHLYDTRT RRVRPFEPLR PGHVGVYVCG PTVQSAPHVG HLRSAVAFDL LRRWLLESGY        60
     AVTYVQNVTD IDDKIIVNAD REGVSVWELA TRETRSFDDA YRAVGILPPT IQPRATGHIP       120
     EMFALIGELM AAGYAYEGDG SVWFRVGRFG DYGALSNQRP DAMQASAEVE AGKEDPRDFA       180
     LWKAARPGEP AWDSPWGSGR PGWHLECSAM AGKYLGDVFD IHGGGLDLVF PHHENERAQT       240
     VCASAARAHD GSGEPEMARY WMHVGLLTTG GTKMSKSLGN SFFVTDALAQ VRPQVLRYHL       300
     LSAHYRSSLE YSPDALAESA AGYGRVETFV RNALDILGSP EEAASLAAEA SPAAAPRPAK       360
     SRGKGRPQGR AAAGPAGTAS PAAAWAAFSA ALDDDLGVSR ALAALFGAVA EGNLVLSKTH       420
     RGELAGWLVV VRRMLTVLGL DPVKQWPAAG GQVRAALDGV MEIVRDLRSS ARARLDYAEA       480
     DSIRDRLRDA GIIVDDTGEG QRWHLA                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page