(data stored in ACNUC7421 zone)

EMBL: CP002299.PE382

CP002299.PE382       Location/Qualifiers
FT   CDS             complement(474775..476109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0384"
FT                   /product="Forkhead-associated protein"
FT                   /note="KEGG: fal:FRAAL6520 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78470"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M7"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADP78470.1"
FT                   /translation="MSARCPEGHLSQDPDYCDQCGLRITSGQDSYGYRSDDRGAPVGSY
FT                   GGGSGRGGGGGGTGAGYDPLGIRRGGEPAGRGTPRGGDPYGGEQYDSGFGAGYDDRPAR
FT                   SSYGADSYDQSGYGSPRGGRDGRAAEGFEGREAGGARGGRDDPDAGYGRGGRDGGGRGA
FT                   PADADGYQSSRGGRDDFGGRGGDQYGRDGGETAYARGGRDDRDGYGGGRGGRDAAAGDG
FT                   GRGYDSDPLGVADRGGARAAGRYPQCPNCRAYYEPGARFCENCGLDFTTGHMPGAGPAG
FT                   SGRRQTDPPVDGGYGEPVITGNAANWNGGGGAPVATTWEAVVEAERDYYDSGDDHRVPF
FT                   PSFYPRRVFPLSGPRLLVGRRSESRGIHPEIDLSGAPEDPGISRAHAVFERQPDGGYAL
FT                   LDPGSTNGTRLNDEPEPIEPHGPVPLQDGDRVYLGAWTRITIRAR"
     MSARCPEGHL SQDPDYCDQC GLRITSGQDS YGYRSDDRGA PVGSYGGGSG RGGGGGGTGA        60
     GYDPLGIRRG GEPAGRGTPR GGDPYGGEQY DSGFGAGYDD RPARSSYGAD SYDQSGYGSP       120
     RGGRDGRAAE GFEGREAGGA RGGRDDPDAG YGRGGRDGGG RGAPADADGY QSSRGGRDDF       180
     GGRGGDQYGR DGGETAYARG GRDDRDGYGG GRGGRDAAAG DGGRGYDSDP LGVADRGGAR       240
     AAGRYPQCPN CRAYYEPGAR FCENCGLDFT TGHMPGAGPA GSGRRQTDPP VDGGYGEPVI       300
     TGNAANWNGG GGAPVATTWE AVVEAERDYY DSGDDHRVPF PSFYPRRVFP LSGPRLLVGR       360
     RSESRGIHPE IDLSGAPEDP GISRAHAVFE RQPDGGYALL DPGSTNGTRL NDEPEPIEPH       420
     GPVPLQDGDR VYLGAWTRIT IRAR                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page