(data stored in ACNUC7421 zone)

EMBL: CP002299.PE383

CP002299.PE383       Location/Qualifiers
FT   CDS             complement(476420..477568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0385"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: fal:FRAAL6518 hypothetical protein; PFAM:
FT                   Protein phosphatase 2C-like; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78471"
FT                   /db_xref="GOA:E3J8M8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M8"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADP78471.1"
FT                   /translation="MTVEHDAAGSYDVGGSGYHGGSYDGGSGYDLPERGMPERGRSLID
FT                   ERTNRCPRCAVVLYGDARYCDSCGFALQGPPVVSGDSDHREKDLGQIAGVCDRGVRHAT
FT                   NEDAMGVAEVFGTMIAVVCDGVSTTPGSGEASAAAAATATTILADAVRAHGPGRAVPVG
FT                   RPGDVLDVLEPGDEDDYHDPVTLPAAVVGGFGPEEAELALHHAVHAAQDMIAQLSAAEG
FT                   RMAPSCTIAAAIISPPVAGGPRTVTIGWVGDSRVYLLGPRWSERLSADDTWAAEAARAG
FT                   LIPASEAETHRRAHTLTRWLGGDAEDVAPHTAVFPIEAPATILVCSDGLWNYASRPDVM
FT                   AAIVNQLPPDATAVEVGRHLIEFAIDQGGHDNITVITARVDR"
     MTVEHDAAGS YDVGGSGYHG GSYDGGSGYD LPERGMPERG RSLIDERTNR CPRCAVVLYG        60
     DARYCDSCGF ALQGPPVVSG DSDHREKDLG QIAGVCDRGV RHATNEDAMG VAEVFGTMIA       120
     VVCDGVSTTP GSGEASAAAA ATATTILADA VRAHGPGRAV PVGRPGDVLD VLEPGDEDDY       180
     HDPVTLPAAV VGGFGPEEAE LALHHAVHAA QDMIAQLSAA EGRMAPSCTI AAAIISPPVA       240
     GGPRTVTIGW VGDSRVYLLG PRWSERLSAD DTWAAEAARA GLIPASEAET HRRAHTLTRW       300
     LGGDAEDVAP HTAVFPIEAP ATILVCSDGL WNYASRPDVM AAIVNQLPPD ATAVEVGRHL       360
     IEFAIDQGGH DNITVITARV DR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page