(data stored in ACNUC7421 zone)

EMBL: CP002299.PE384

CP002299.PE384       Location/Qualifiers
FT   CDS             478266..479366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0386"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: fal:FRAAL6517 tRNA/rRNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78472"
FT                   /db_xref="GOA:E3J8M9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M9"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADP78472.1"
FT                   /translation="MARGGQGGRAAKAGSHRKGASIGSGGQRRRALEGKGATPPAEMRK
FT                   GHPAQRRANAAARSETTSTRAGSTARPTGARDGGPARAGHTGQRDGGPARAGNTGQRDG
FT                   AATGRGGPAGRRPGETDELVVGRNAVVEALRAGIPAATLYVAGGLEFDERLTEARKLAG
FT                   RAGMAVVDIGRFELDRLCGVAPHQGLALVVPPFRYAHPDDLLARARASDPGLLVALDGV
FT                   TDPRNLGAVVRSAAAFGAQGVVVPERRAAGMTAAAWKTSAGAAARLPVARATNLNRTLR
FT                   SYADGGLVVVGLAANADVSLDDLAAATDPIVLVIGSEGRGLSRLVGENCDLLVRIPMAG
FT                   EVESLNAGVAAGVALAEIARRRRQTS"
     MARGGQGGRA AKAGSHRKGA SIGSGGQRRR ALEGKGATPP AEMRKGHPAQ RRANAAARSE        60
     TTSTRAGSTA RPTGARDGGP ARAGHTGQRD GGPARAGNTG QRDGAATGRG GPAGRRPGET       120
     DELVVGRNAV VEALRAGIPA ATLYVAGGLE FDERLTEARK LAGRAGMAVV DIGRFELDRL       180
     CGVAPHQGLA LVVPPFRYAH PDDLLARARA SDPGLLVALD GVTDPRNLGA VVRSAAAFGA       240
     QGVVVPERRA AGMTAAAWKT SAGAAARLPV ARATNLNRTL RSYADGGLVV VGLAANADVS       300
     LDDLAAATDP IVLVIGSEGR GLSRLVGENC DLLVRIPMAG EVESLNAGVA AGVALAEIAR       360
     RRRQTS                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page