(data stored in ACNUC7421 zone)

EMBL: CP002299.PE388

CP002299.PE388       Location/Qualifiers
FT   CDS             complement(482124..483131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0390"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: kfl:Kfla_6883
FT                   acetamidase/formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78476"
FT                   /db_xref="GOA:E3J8N3"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N3"
FT                   /inference="protein motif:PFAM:PF03069"
FT                   /protein_id="ADP78476.1"
FT                   /translation="MEVVEFRPRPAQFAWTFGGVAPIRTVKPGTVLRLWTEDAFGGRLR
FT                   TTSDLPSSSLTMPFVNPQTGPFYVEGAEPGDTLVLHLVELTPARGWGASSTIPFFGGLT
FT                   GTDRTATLAPPLPERTWIYEVDRAKSTVTFTALSSEFQVDLPMSPMLGTVGVAPAAMEA
FT                   RSALVPDRFGGNMDTPEMRAGATCYLGVNVDGALFSIGDGHYRQGEGEACGTAVEGAMD
FT                   VTLIVELVKGRAPQWPRLESDTHFITVGSSRPLEDAWRIGQVEMVTWLSELYGLETLDS
FT                   YQLLSQISEAPLANVVDVNYSALAKIAKAYLPPVAAYDGMHRYLRDLAARIPPL"
     MEVVEFRPRP AQFAWTFGGV APIRTVKPGT VLRLWTEDAF GGRLRTTSDL PSSSLTMPFV        60
     NPQTGPFYVE GAEPGDTLVL HLVELTPARG WGASSTIPFF GGLTGTDRTA TLAPPLPERT       120
     WIYEVDRAKS TVTFTALSSE FQVDLPMSPM LGTVGVAPAA MEARSALVPD RFGGNMDTPE       180
     MRAGATCYLG VNVDGALFSI GDGHYRQGEG EACGTAVEGA MDVTLIVELV KGRAPQWPRL       240
     ESDTHFITVG SSRPLEDAWR IGQVEMVTWL SELYGLETLD SYQLLSQISE APLANVVDVN       300
     YSALAKIAKA YLPPVAAYDG MHRYLRDLAA RIPPL                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page