(data stored in ACNUC7421 zone)

EMBL: CP002299.PE389

CP002299.PE389       Location/Qualifiers
FT   CDS             483335..484531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0391"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   fal:FRAAL1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78477"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N4"
FT                   /inference="protein motif:PFAM:PF06224"
FT                   /protein_id="ADP78477.1"
FT                   /translation="MRRVAAQLLASPLPARPTAAQRVRTVVQVVGHVLAVQAQDLRGLR
FT                   LAIRSRAAGLTVADVDRAFAERRLVVTWLNRGTLHLVRAEDYGWLHALTAPRQEVNVRR
FT                   RLGEEGVSPAEAERGVALVERALADDGPLSRAQLRDRLAAAGIPVAGQALIHILGLASL
FT                   RGLLVRGPIVGSEQAYVLVRDWLGPVAATSDALDAAPLAAVDESRTPLPAQDETGGTES
FT                   DRDTALVRLAVRYLAAHGPAGERDLASWSGLPLTDARRGLALAAGSGLTEPIGTEPLGA
FT                   GLVDLAGRPRGLGDLPWDEVSPDSLPTRLLGPFDPILHGWAARDWVTGPYRSIVTVNGI
FT                   FRAIALVAGRAAGTWTMPAGQVSLALFEPLPAAVELALRAESSDVRRFLAGDPGLAAG"
     MRRVAAQLLA SPLPARPTAA QRVRTVVQVV GHVLAVQAQD LRGLRLAIRS RAAGLTVADV        60
     DRAFAERRLV VTWLNRGTLH LVRAEDYGWL HALTAPRQEV NVRRRLGEEG VSPAEAERGV       120
     ALVERALADD GPLSRAQLRD RLAAAGIPVA GQALIHILGL ASLRGLLVRG PIVGSEQAYV       180
     LVRDWLGPVA ATSDALDAAP LAAVDESRTP LPAQDETGGT ESDRDTALVR LAVRYLAAHG       240
     PAGERDLASW SGLPLTDARR GLALAAGSGL TEPIGTEPLG AGLVDLAGRP RGLGDLPWDE       300
     VSPDSLPTRL LGPFDPILHG WAARDWVTGP YRSIVTVNGI FRAIALVAGR AAGTWTMPAG       360
     QVSLALFEPL PAAVELALRA ESSDVRRFLA GDPGLAAG                               398
//

If you have problems or comments...

PBIL Back to PBIL home page