(data stored in ACNUC7421 zone)

EMBL: CP002299.PE39

CP002299.PE39        Location/Qualifiers
FT   CDS             44094..45620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0039"
FT                   /product="secretory lipase"
FT                   /note="KEGG: fal:FRAAL0030 putative exported lipase;
FT                   manually curated; PFAM: secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78127"
FT                   /db_xref="GOA:E3J289"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J289"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ADP78127.1"
FT                   /translation="MFFGVATRPRRTCNVWLVPVDVPLESPRIDGYVTGTPYCPASSPT
FT                   GTSIGAFLLPGDCGSGRSAHRATAGAPGRRWSGAGLRRDPRETSRRQPGEYARSVVRRA
FT                   NLGASGRGRTCRLLACLVAALALAAPLAGCSAGSSAAPGGQMAQSLPPGAPGSLITATP
FT                   VAGAPAGIAAWRVIYHTRDQNGADVAASGLVLSPAPGHGGAVPSGGRRVVAFGHGTTGV
FT                   ADACAPSLAQPPLTAVGNTFSLVQQGYVVAAADYIGLGTPGDHAIYVATPAAQALLDVV
FT                   RAARALPAAHAGSEVIIWGYSQGGQAALAAGVMTDGYAPELKVRGVVAMAPLADLPRSL
FT                   ASLRDENDTGVAYILMAAYGVSVAYPGVNLAADLTTQGKRLLSILQHKCAVDLVTASTG
FT                   LTDAQVFLRDPLTIEPFVSRFAAQRKAVIGAMPPLLLLQGDADNVIRQPITDGVVRDLC
FT                   AAGTAVDYHRYPVAGHSTVFSTSSRDMYTWIANRFRADPAPMHSICGPAL"
     MFFGVATRPR RTCNVWLVPV DVPLESPRID GYVTGTPYCP ASSPTGTSIG AFLLPGDCGS        60
     GRSAHRATAG APGRRWSGAG LRRDPRETSR RQPGEYARSV VRRANLGASG RGRTCRLLAC       120
     LVAALALAAP LAGCSAGSSA APGGQMAQSL PPGAPGSLIT ATPVAGAPAG IAAWRVIYHT       180
     RDQNGADVAA SGLVLSPAPG HGGAVPSGGR RVVAFGHGTT GVADACAPSL AQPPLTAVGN       240
     TFSLVQQGYV VAAADYIGLG TPGDHAIYVA TPAAQALLDV VRAARALPAA HAGSEVIIWG       300
     YSQGGQAALA AGVMTDGYAP ELKVRGVVAM APLADLPRSL ASLRDENDTG VAYILMAAYG       360
     VSVAYPGVNL AADLTTQGKR LLSILQHKCA VDLVTASTGL TDAQVFLRDP LTIEPFVSRF       420
     AAQRKAVIGA MPPLLLLQGD ADNVIRQPIT DGVVRDLCAA GTAVDYHRYP VAGHSTVFST       480
     SSRDMYTWIA NRFRADPAPM HSICGPAL                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page