(data stored in ACNUC7421 zone)

EMBL: CP002299.PE393

CP002299.PE393       Location/Qualifiers
FT   CDS             complement(488824..489156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0395"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sro:Sros_6088 transcriptional regulator protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78481"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N8"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADP78481.1"
FT                   /translation="MTEPAFFVLTALVGAPRHGYGIVGEVRDLSQGRVQLKVGTLYGVL
FT                   ERLVADGLVALDREEIQQGRLRRYYRLTEPGSEALAAEAGRQEANAQVASRRLRALRPA
FT                   GTGGSA"
     MTEPAFFVLT ALVGAPRHGY GIVGEVRDLS QGRVQLKVGT LYGVLERLVA DGLVALDREE        60
     IQQGRLRRYY RLTEPGSEAL AAEAGRQEAN AQVASRRLRA LRPAGTGGSA                  110
//

If you have problems or comments...

PBIL Back to PBIL home page