(data stored in ACNUC7421 zone)

EMBL: CP002299.PE394

CP002299.PE394       Location/Qualifiers
FT   CDS             489382..491922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0396"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: cai:Caci_8514 fibronectin type III domain
FT                   protein; PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78482"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N9"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADP78482.1"
FT                   /translation="MRRWAGPAALVALLVAGVAALVAGSAQGVAARSVSLDDVSAWLLS
FT                   PAVGEAELVDGNSGAVVTRVELGVGALTGTQSGTGEFVADSATGKLRRIDGATYRVSAP
FT                   ATFGKPGEALGVYPAGETVFAVDQPTGLVSLLDPRTLAVRQTYSLAAKVAAGGIVTQGA
FT                   DVLWAVGATTGDLERVDGSGTTIVRHAVDPARTTLVTAAGLPVAVDLTARQVVRLGSRG
FT                   VTGAGTCVDVAATDSSVQVVGSADRPAVYAVSGSRGVLLVSDLATGRCGDAVNLGVAGH
FT                   RLGQPREAAGRVFVPDYTSGQVLVVDVTAGRVIADPTVMPPSTAFELRDEGAVVFYNDP
FT                   ATAKAGVISLDGAIRPIEKYSPATVGTAPGGPASLAGKLPSDAAGGSQPPTGGTSPPSG
FT                   VQPTAVPTRPAATRPQRPTAPLTTIPPVGAGPAVASNDGRTAPTTSTTTEAPATGGGAP
FT                   TVRIAVSAPQARVGTALTMQAVLVAADGTVTAGKLAQVSWSFGDGGSATGSQVTHAWTA
FT                   SGVYTVSADVRLTDGTSAAPVTSVTVVAPNVPPVTTPPVTNPPVTVPPVTTPPTTKPAV
FT                   SPLKAVLSANKGSCTQDSANVTVDASGSAGGSGPLTYAFDFGDGTTAGPASAATVEHGY
FT                   SQTGPFTVTVTITDATGASAKATATATLLHLAASATSVTVGQSVTLTGTGVCAGASLDL
FT                   NIGAQYAGGTSTSGNIGHNVHEPNPYTSTWGTGTTTVSAHWSESDPYSDSNRLTITVTD
FT                   PAPPPPLQVTASSTSITLGQSVTLTATGGVHGSDGTYSWYGANPSGLGTSLCGTTASCT
FT                   TTPDTTGTWKYSVQVYDNAGNRAESNQLAVTVSP"
     MRRWAGPAAL VALLVAGVAA LVAGSAQGVA ARSVSLDDVS AWLLSPAVGE AELVDGNSGA        60
     VVTRVELGVG ALTGTQSGTG EFVADSATGK LRRIDGATYR VSAPATFGKP GEALGVYPAG       120
     ETVFAVDQPT GLVSLLDPRT LAVRQTYSLA AKVAAGGIVT QGADVLWAVG ATTGDLERVD       180
     GSGTTIVRHA VDPARTTLVT AAGLPVAVDL TARQVVRLGS RGVTGAGTCV DVAATDSSVQ       240
     VVGSADRPAV YAVSGSRGVL LVSDLATGRC GDAVNLGVAG HRLGQPREAA GRVFVPDYTS       300
     GQVLVVDVTA GRVIADPTVM PPSTAFELRD EGAVVFYNDP ATAKAGVISL DGAIRPIEKY       360
     SPATVGTAPG GPASLAGKLP SDAAGGSQPP TGGTSPPSGV QPTAVPTRPA ATRPQRPTAP       420
     LTTIPPVGAG PAVASNDGRT APTTSTTTEA PATGGGAPTV RIAVSAPQAR VGTALTMQAV       480
     LVAADGTVTA GKLAQVSWSF GDGGSATGSQ VTHAWTASGV YTVSADVRLT DGTSAAPVTS       540
     VTVVAPNVPP VTTPPVTNPP VTVPPVTTPP TTKPAVSPLK AVLSANKGSC TQDSANVTVD       600
     ASGSAGGSGP LTYAFDFGDG TTAGPASAAT VEHGYSQTGP FTVTVTITDA TGASAKATAT       660
     ATLLHLAASA TSVTVGQSVT LTGTGVCAGA SLDLNIGAQY AGGTSTSGNI GHNVHEPNPY       720
     TSTWGTGTTT VSAHWSESDP YSDSNRLTIT VTDPAPPPPL QVTASSTSIT LGQSVTLTAT       780
     GGVHGSDGTY SWYGANPSGL GTSLCGTTAS CTTTPDTTGT WKYSVQVYDN AGNRAESNQL       840
     AVTVSP                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page