(data stored in ACNUC7421 zone)

EMBL: CP002299.PE395

CP002299.PE395       Location/Qualifiers
FT   CDS             complement(491950..492759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0397"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: sro:Sros_6478
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78483"
FT                   /db_xref="GOA:E3J8P0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP78483.1"
FT                   /translation="MATPSNTYTHGHHESVLRSHRWRTAENSAAYLLPALRPGMTLLDV
FT                   GAGPGTITVDLAERVAPGQVTAVEVSESVLELPRAEAARRGAHTITFAVADVHALRFPD
FT                   DSFDVVHAHQVLQHVADPVLALREMRRVCRPGGVVAVRDSSYSDFDWTPRPPELDEWLD
FT                   LYLRAARANGGEPDAGRHLAGWAREAGFTDVTATTGHWVYESDADRRWWGEMWAERILR
FT                   SDMAGQALARGLASQEDLERISRAWRDWAATPAAAITIPHGEVLARP"
     MATPSNTYTH GHHESVLRSH RWRTAENSAA YLLPALRPGM TLLDVGAGPG TITVDLAERV        60
     APGQVTAVEV SESVLELPRA EAARRGAHTI TFAVADVHAL RFPDDSFDVV HAHQVLQHVA       120
     DPVLALREMR RVCRPGGVVA VRDSSYSDFD WTPRPPELDE WLDLYLRAAR ANGGEPDAGR       180
     HLAGWAREAG FTDVTATTGH WVYESDADRR WWGEMWAERI LRSDMAGQAL ARGLASQEDL       240
     ERISRAWRDW AATPAAAITI PHGEVLARP                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page