(data stored in ACNUC7421 zone)

EMBL: CP002299.PE396

CP002299.PE396       Location/Qualifiers
FT   CDS             492942..494084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0398"
FT                   /product="Microsomal epoxide hydrolase"
FT                   /EC_number="3.3.2.9"
FT                   /note="KEGG: cwo:Cwoe_0285 epoxide hydrolase domain
FT                   protein; PFAM: Epoxide hydrolase domain protein; alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78484"
FT                   /db_xref="GOA:E3J8P1"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P1"
FT                   /inference="protein motif:PRIAM:3.3.2.9"
FT                   /protein_id="ADP78484.1"
FT                   /translation="MTTLPDLRPFRIDVPRRDLDDLRTRLAAARWPAEVTGAGSDYGMP
FT                   LGVVQRLANRWSSGYDWRAQEARLNEIPQFTTTIDGQNIHFLHVRSGEPGALPLLLLHG
FT                   WPSSVAEFLGMIGPLTDPRGHGGGSAPAFDIVVPSLPGYGFSGPVTEPGWDSARMARAF
FT                   ATLMERLGYRRWGAVGGDAGALVGRELGILAPAGLVGVHLLQIFAFPSGDPAELAALSE
FT                   ADRASLSGSTADFQSKAGYQKIQQTRPQTLGYGLTDSPIGQLAWNAELWTGWGDYADYL
FT                   DVDTYLTHVSIYWFTRTGVSSARHYYEDAHSGAGYRELPNKVPTAVAVFPEDYRTVRAF
FT                   AERANNVVRYREFDRGGHFAYTTDPDLVVDDLRQFFADLD"
     MTTLPDLRPF RIDVPRRDLD DLRTRLAAAR WPAEVTGAGS DYGMPLGVVQ RLANRWSSGY        60
     DWRAQEARLN EIPQFTTTID GQNIHFLHVR SGEPGALPLL LLHGWPSSVA EFLGMIGPLT       120
     DPRGHGGGSA PAFDIVVPSL PGYGFSGPVT EPGWDSARMA RAFATLMERL GYRRWGAVGG       180
     DAGALVGREL GILAPAGLVG VHLLQIFAFP SGDPAELAAL SEADRASLSG STADFQSKAG       240
     YQKIQQTRPQ TLGYGLTDSP IGQLAWNAEL WTGWGDYADY LDVDTYLTHV SIYWFTRTGV       300
     SSARHYYEDA HSGAGYRELP NKVPTAVAVF PEDYRTVRAF AERANNVVRY REFDRGGHFA       360
     YTTDPDLVVD DLRQFFADLD                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page