(data stored in ACNUC7421 zone)

EMBL: CP002299.PE398

CP002299.PE398       Location/Qualifiers
FT   CDS             complement(495490..495822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78486"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1677"
FT                   /protein_id="ADP78486.1"
FT                   /translation="MSFDLAIWEGERPADDPAAGRAFDDLVQRYDEEEAEAPPTERIIA
FT                   YVEALSRRWPDEETGPWSVTPEPAGPFLYLCVAWSMADEVAAYAAGLARSMDLICYDPQ
FT                   SERLLT"
     MSFDLAIWEG ERPADDPAAG RAFDDLVQRY DEEEAEAPPT ERIIAYVEAL SRRWPDEETG        60
     PWSVTPEPAG PFLYLCVAWS MADEVAAYAA GLARSMDLIC YDPQSERLLT                  110
//

If you have problems or comments...

PBIL Back to PBIL home page