(data stored in ACNUC7421 zone)

EMBL: CP002299.PE400

CP002299.PE400       Location/Qualifiers
FT   CDS             complement(496489..497262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0402"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sco:SCO6282 3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78488"
FT                   /db_xref="GOA:E3J8P5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP78488.1"
FT                   /translation="MGTLAAKTALVTGASRGIGRAVALRLAREGALVAVHYGSNEAAAK
FT                   DTVDTITAAGGRAFALRTHLGHAGDAEALWSAFDDAIRAHTDSPAVDVIVNNAGIALYA
FT                   TVTDVEDKTFDEVFAVNAKAPFFILQHGLDRLREGGRVINISSGAARLATPMLVAYAMT
FT                   KGALNALTRTLALELGPRNITVNSVEPGIVETDIAFFLSDPRMNELAASWSAFNRLGQP
FT                   ADIADVVAFLASPDARWITGQFIDATGGFLLGPKF"
     MGTLAAKTAL VTGASRGIGR AVALRLAREG ALVAVHYGSN EAAAKDTVDT ITAAGGRAFA        60
     LRTHLGHAGD AEALWSAFDD AIRAHTDSPA VDVIVNNAGI ALYATVTDVE DKTFDEVFAV       120
     NAKAPFFILQ HGLDRLREGG RVINISSGAA RLATPMLVAY AMTKGALNAL TRTLALELGP       180
     RNITVNSVEP GIVETDIAFF LSDPRMNELA ASWSAFNRLG QPADIADVVA FLASPDARWI       240
     TGQFIDATGG FLLGPKF                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page