(data stored in ACNUC7421 zone)

EMBL: CP002299.PE403

CP002299.PE403       Location/Qualifiers
FT   CDS             complement(499021..500262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0405"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="KEGG: sro:Sros_5459 RNA polymerase sigma-70 factor,
FT                   ECF subfamily; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78491"
FT                   /db_xref="GOA:E3J8P8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADP78491.1"
FT                   /translation="MTDARIEDLLRELAPQVLGVLTRRYGRFDACEDATQEALLKAARR
FT                   WPTDGIPENPGGWLQTVAYRVLVDELRRDGSRRRREEAAYASTPQSQALAGLHEAGQHD
FT                   DSLELFFLCCHPSLSTPSQIALTLRAVGGLTTTQIAGAFLVPETTMAQRISRAKATIEA
FT                   GGRRLEMPGRAAGERLSTVQHVLYLIFNEGYTATTGADLMVPSLSDEAIRLTRLLRRLL
FT                   PADGETAGLLALMLLTDARRPARTRGDGSLVPLAEQDRSLWTSALIAEGLALISQVLPV
FT                   GKVGPYQLQAAIAAVYVEAPTMDETDWPQILALYDLLERAAPNPMTTLNRAVAVAMVHG
FT                   PAAGLDIVSSLETDGRLARSHRILATRAHLRQRAGDRDAAAADYRQAAALTASIPERRY
FT                   LIGRAVALGTDGDG"
     MTDARIEDLL RELAPQVLGV LTRRYGRFDA CEDATQEALL KAARRWPTDG IPENPGGWLQ        60
     TVAYRVLVDE LRRDGSRRRR EEAAYASTPQ SQALAGLHEA GQHDDSLELF FLCCHPSLST       120
     PSQIALTLRA VGGLTTTQIA GAFLVPETTM AQRISRAKAT IEAGGRRLEM PGRAAGERLS       180
     TVQHVLYLIF NEGYTATTGA DLMVPSLSDE AIRLTRLLRR LLPADGETAG LLALMLLTDA       240
     RRPARTRGDG SLVPLAEQDR SLWTSALIAE GLALISQVLP VGKVGPYQLQ AAIAAVYVEA       300
     PTMDETDWPQ ILALYDLLER AAPNPMTTLN RAVAVAMVHG PAAGLDIVSS LETDGRLARS       360
     HRILATRAHL RQRAGDRDAA AADYRQAAAL TASIPERRYL IGRAVALGTD GDG              413
//

If you have problems or comments...

PBIL Back to PBIL home page