(data stored in ACNUC7421 zone)

EMBL: CP002299.PE405

CP002299.PE405       Location/Qualifiers
FT   CDS             500859..501305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_1816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78493"
FT                   /db_xref="GOA:E3J8Q0"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q0"
FT                   /inference="similar to AA sequence:KEGG:Gobs_1816"
FT                   /protein_id="ADP78493.1"
FT                   /translation="MSTSSISTRPSAAFLARRPVWQVSYLAGLAASVVVELWGLAARIV
FT                   GVPMRAAGLGSHHATPITVGMFAMGTMVVTFWFTFVVVLMARFAKSPARTYLRTTVPLL
FT                   VLSLVLPITAADTALTTGLTLAAAHLIAAAIIIPTVRRRLSQPR"
     MSTSSISTRP SAAFLARRPV WQVSYLAGLA ASVVVELWGL AARIVGVPMR AAGLGSHHAT        60
     PITVGMFAMG TMVVTFWFTF VVVLMARFAK SPARTYLRTT VPLLVLSLVL PITAADTALT       120
     TGLTLAAAHL IAAAIIIPTV RRRLSQPR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page