(data stored in ACNUC7421 zone)

EMBL: CP002299.PE407

CP002299.PE407       Location/Qualifiers
FT   CDS             complement(502270..503739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0409"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="manually curated; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; KEGG:
FT                   nca:Noca_4567 DEAD/DEAH box helicase domain-containing
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78495"
FT                   /db_xref="GOA:E3J8Q2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q2"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADP78495.1"
FT                   /translation="MSSFTDLGVPARLTSVLTRLAIETPTPIQRATLPDALAGRDVLGR
FT                   GRTGSGKTLAFLLPVVARLSGGPRAQAGAPRALILAPTRELAAQIDTALQPLAAVAGLT
FT                   SCTVFGGVGQNPQVAAIRRGVDIVVACPGRLEDLIKQRHCSLAQVKITVLDEADHMADL
FT                   GFLPAVRRLLGQTPSGGQRMLFSATLDKAIDTLVRQYLNKPAVHEADSAQSPVGTMAHH
FT                   VLHVERDSRLPVLVDLSSAPGRTVVFTRTKHGAKALARHLNRAGVPTVELHGNLSQNAR
FT                   TRNLDDFQTGRAAALVATDIAARGIHVDDVALVIHADPPADHKAYLHRSGRTARAGNSG
FT                   TVITLATTDQLREVSQLARTAGIKPATTRVASADHPILSTLAPGVRSLTSPTVTAEPET
FT                   RTSPAQRRPAAGTRGTEPTPRAGRRRGRRPASGQRGGRATASAGRATASRPAAATARGS
FT                   SADHEAGPSSSERPRSRPTHSAATFSARRGR"
     MSSFTDLGVP ARLTSVLTRL AIETPTPIQR ATLPDALAGR DVLGRGRTGS GKTLAFLLPV        60
     VARLSGGPRA QAGAPRALIL APTRELAAQI DTALQPLAAV AGLTSCTVFG GVGQNPQVAA       120
     IRRGVDIVVA CPGRLEDLIK QRHCSLAQVK ITVLDEADHM ADLGFLPAVR RLLGQTPSGG       180
     QRMLFSATLD KAIDTLVRQY LNKPAVHEAD SAQSPVGTMA HHVLHVERDS RLPVLVDLSS       240
     APGRTVVFTR TKHGAKALAR HLNRAGVPTV ELHGNLSQNA RTRNLDDFQT GRAAALVATD       300
     IAARGIHVDD VALVIHADPP ADHKAYLHRS GRTARAGNSG TVITLATTDQ LREVSQLART       360
     AGIKPATTRV ASADHPILST LAPGVRSLTS PTVTAEPETR TSPAQRRPAA GTRGTEPTPR       420
     AGRRRGRRPA SGQRGGRATA SAGRATASRP AAATARGSSA DHEAGPSSSE RPRSRPTHSA       480
     ATFSARRGR                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page