(data stored in ACNUC7421 zone)

EMBL: CP002299.PE408

CP002299.PE408       Location/Qualifiers
FT   CDS             complement(504084..505535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0410"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: sco:SCO4377 serine-threonine protein kinase;
FT                   PFAM: Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78496"
FT                   /db_xref="GOA:E3J8Q3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q3"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78496.1"
FT                   /translation="MTNDRLFLPLLDADPRVVSGYELRARIGEGGMGTVFLATSRAGRP
FT                   IALKLIRPEFADHADFRRRFAAEVAIARRVQGAYTVPVVDANPDAARPWVATAYIPAPN
FT                   LSAAVRHAGPLPARTVLGLLAGVAEALESIHQAGVIHRDLKPGNVMVAAEGPLVIDFGL
FT                   ARATEGTSRELSRPGVAVGTPVFMSPEQVENGQVGRASDIFSLGSTAYFAATGDYPFGG
FT                   DGTVFHRIEYGEPDWDQVPWPLPLVLTRCLAKAPAQRASCEEIIDLCRRLSMELAVRLD
FT                   SVTVPTTYRGLLGEGWLPDTIAAEISSYRRAAATTLARRGREPGTHLVEETSTEDLEIP
FT                   APASRTVPAGRVPRVTAGILAAGAVATLLVLVGALLLVLGHRHGLAATGAVSTSLAPTL
FT                   TNLAEAPQATITPQVSASPRLSTTVSHTVPATELSATVTPSLAPAQTTPPASPDRGLLG
FT                   GLLYLLLGGPAPDPPPASATSTPAH"
     MTNDRLFLPL LDADPRVVSG YELRARIGEG GMGTVFLATS RAGRPIALKL IRPEFADHAD        60
     FRRRFAAEVA IARRVQGAYT VPVVDANPDA ARPWVATAYI PAPNLSAAVR HAGPLPARTV       120
     LGLLAGVAEA LESIHQAGVI HRDLKPGNVM VAAEGPLVID FGLARATEGT SRELSRPGVA       180
     VGTPVFMSPE QVENGQVGRA SDIFSLGSTA YFAATGDYPF GGDGTVFHRI EYGEPDWDQV       240
     PWPLPLVLTR CLAKAPAQRA SCEEIIDLCR RLSMELAVRL DSVTVPTTYR GLLGEGWLPD       300
     TIAAEISSYR RAAATTLARR GREPGTHLVE ETSTEDLEIP APASRTVPAG RVPRVTAGIL       360
     AAGAVATLLV LVGALLLVLG HRHGLAATGA VSTSLAPTLT NLAEAPQATI TPQVSASPRL       420
     STTVSHTVPA TELSATVTPS LAPAQTTPPA SPDRGLLGGL LYLLLGGPAP DPPPASATST       480
     PAH                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page