(data stored in ACNUC7421 zone)

EMBL: CP002299.PE412

CP002299.PE412       Location/Qualifiers
FT   CDS             complement(508633..509256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78500"
FT                   /db_xref="GOA:E3J8Q7"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q7"
FT                   /inference="similar to AA sequence:KEGG:SACE_1315"
FT                   /protein_id="ADP78500.1"
FT                   /translation="MTIEDRLTTLDTLWSVWAEHGLAMADEHWVRPTRLGTWDVRSLYA
FT                   HVGSWPLAFTSLVDRVRDAEPTHATAAALLRDFNTPDGSANRLRDWSAARALEDAAKYT
FT                   TEQMVEQFASAGPRAIATARQLGPVAVDYFGQAILRLDEAVSIGIVEATVHLLDLHRAL
FT                   GQAPNVPADGLAHTTALLAEMAPPVDFIEAATGRSAADLFPVLT"
     MTIEDRLTTL DTLWSVWAEH GLAMADEHWV RPTRLGTWDV RSLYAHVGSW PLAFTSLVDR        60
     VRDAEPTHAT AAALLRDFNT PDGSANRLRD WSAARALEDA AKYTTEQMVE QFASAGPRAI       120
     ATARQLGPVA VDYFGQAILR LDEAVSIGIV EATVHLLDLH RALGQAPNVP ADGLAHTTAL       180
     LAEMAPPVDF IEAATGRSAA DLFPVLT                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page