(data stored in ACNUC7421 zone)

EMBL: CP002299.PE414

CP002299.PE414       Location/Qualifiers
FT   CDS             complement(513419..513997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0419"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kra:Krad_2116
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78502"
FT                   /db_xref="GOA:E3J8Q9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78502.1"
FT                   /translation="MARWQPGATQRLVAAAVDLFAEQGYDATTVAQIAERAGVTRSTFF
FT                   RHFSDKRELLVAGQETLSRLLADGIIEAPANASPLDAVAAGLERASGEMGPANRELGPR
FT                   LKAAVAASTELQERDTLKSVGLAAAMTAALIARGVPEPTAHLAGEMGILAFKRGYTRWS
FT                   EGDRDDGTGLAQHALAALDELRTAAASLG"
     MARWQPGATQ RLVAAAVDLF AEQGYDATTV AQIAERAGVT RSTFFRHFSD KRELLVAGQE        60
     TLSRLLADGI IEAPANASPL DAVAAGLERA SGEMGPANRE LGPRLKAAVA ASTELQERDT       120
     LKSVGLAAAM TAALIARGVP EPTAHLAGEM GILAFKRGYT RWSEGDRDDG TGLAQHALAA       180
     LDELRTAAAS LG                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page