(data stored in ACNUC7421 zone)

EMBL: CP002299.PE416

CP002299.PE416       Location/Qualifiers
FT   CDS             515395..515844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0421"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: fal:FRAAL3595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78504"
FT                   /db_xref="GOA:E3J8R1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024031"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADP78504.1"
FT                   /translation="MTATDDPATIAPGSRVFSDSELSYLAGQRLGRLATVAPDNSPQNS
FT                   PVGFQVRPDGVVEIYGYNLGASRKFRNVAATGVVSLVVDDIASVDPWRVRGVEIRGTAA
FT                   AVTDIEPPQPWLSHEVIRIHPRRVLSWGLDADVEGLQARTIAADA"
     MTATDDPATI APGSRVFSDS ELSYLAGQRL GRLATVAPDN SPQNSPVGFQ VRPDGVVEIY        60
     GYNLGASRKF RNVAATGVVS LVVDDIASVD PWRVRGVEIR GTAAAVTDIE PPQPWLSHEV       120
     IRIHPRRVLS WGLDADVEGL QARTIAADA                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page