(data stored in ACNUC7421 zone)

EMBL: CP002299.PE417

CP002299.PE417       Location/Qualifiers
FT   CDS             516052..517017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0422"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78505"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R2"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADP78505.1"
FT                   /translation="MPTPPNQLADRNPAAAPDAARLEEVRPGVHAWVQPDGSWWVNNAG
FT                   AVGGAEGLLVIDTCATADRTQRFLTALADATGGAPIRLAVNTHQHGDHTYGNSLLPAAT
FT                   VLIGHEEMREGLRTDFIIDGCPAFWAPVPDWGPIERRLPDVAITASTTVYVGERRVDLL
FT                   HPGGPAHTTGDLVAWLPDDRVLFAGDLVFAGLTPLVFMGSVTGALAAVDWLADLEPEVI
FT                   VPGHGPVLVGGEIDRVLNEHRRYYEFVLALAEGGLARGATPLEVAGAVDLGEFAGWADA
FT                   ERLVLNLHRDYADRAGQEIDLVAALCDAVTWLGHPMPTSV"
     MPTPPNQLAD RNPAAAPDAA RLEEVRPGVH AWVQPDGSWW VNNAGAVGGA EGLLVIDTCA        60
     TADRTQRFLT ALADATGGAP IRLAVNTHQH GDHTYGNSLL PAATVLIGHE EMREGLRTDF       120
     IIDGCPAFWA PVPDWGPIER RLPDVAITAS TTVYVGERRV DLLHPGGPAH TTGDLVAWLP       180
     DDRVLFAGDL VFAGLTPLVF MGSVTGALAA VDWLADLEPE VIVPGHGPVL VGGEIDRVLN       240
     EHRRYYEFVL ALAEGGLARG ATPLEVAGAV DLGEFAGWAD AERLVLNLHR DYADRAGQEI       300
     DLVAALCDAV TWLGHPMPTS V                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page