(data stored in ACNUC7421 zone)

EMBL: CP002299.PE418

CP002299.PE418       Location/Qualifiers
FT   CDS             517031..517972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0423"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   sco:SCO6303 hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78506"
FT                   /db_xref="GOA:E3J8R3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R3"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADP78506.1"
FT                   /translation="MRFVTYVDDDGDRVGVVADGQVHALPSGVTLLDLLRAEDGLREAG
FT                   ERALASPSAVRPYSDVRLRAPLPTPPTVRDFMTFERHLEGVLLLGGATVPERWYEAPAF
FT                   YFTNPYAVRGPHDDVPVPPGCQLFDLELEVAAVVGRTGRDVSPEAGDSYIAGYTIMNDW
FT                   SARDLQFAEMEVRLGPTKGKDTATTLGPMLVTPDELQDWAAGTSYDLAMTVEINGELIG
FT                   EDRLSSMAFTFGDLVAYASRGTEVRPGDVLGSGTCGGGCLAELWGRNGFDAHPPLRPGD
FT                   LVTVSVEQLGALTTRITAGTDPVPIPAARRRG"
     MRFVTYVDDD GDRVGVVADG QVHALPSGVT LLDLLRAEDG LREAGERALA SPSAVRPYSD        60
     VRLRAPLPTP PTVRDFMTFE RHLEGVLLLG GATVPERWYE APAFYFTNPY AVRGPHDDVP       120
     VPPGCQLFDL ELEVAAVVGR TGRDVSPEAG DSYIAGYTIM NDWSARDLQF AEMEVRLGPT       180
     KGKDTATTLG PMLVTPDELQ DWAAGTSYDL AMTVEINGEL IGEDRLSSMA FTFGDLVAYA       240
     SRGTEVRPGD VLGSGTCGGG CLAELWGRNG FDAHPPLRPG DLVTVSVEQL GALTTRITAG       300
     TDPVPIPAAR RRG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page