(data stored in ACNUC7421 zone)

EMBL: CP002299.PE420

CP002299.PE420       Location/Qualifiers
FT   CDS             518174..518407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78508"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R5"
FT                   /inference="similar to AA sequence:KEGG:Srot_2150"
FT                   /protein_id="ADP78508.1"
FT                   /translation="MGDPAVIGRAGHVTVATRGPGGAGEVQVSVRGGVETYLAWSDDPL
FT                   PKGTSVLVIGTRGPRTVDVVPWTDTLALKSDC"
     MGDPAVIGRA GHVTVATRGP GGAGEVQVSV RGGVETYLAW SDDPLPKGTS VLVIGTRGPR        60
     TVDVVPWTDT LALKSDC                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page