(data stored in ACNUC7421 zone)

EMBL: CP002299.PE426

CP002299.PE426       Location/Qualifiers
FT   CDS             522639..522914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0431"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   fal:FRAAL0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78514"
FT                   /db_xref="GOA:E3J9V2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V2"
FT                   /inference="protein motif:PFAM:PF04226"
FT                   /protein_id="ADP78514.1"
FT                   /translation="MVWTIIFWLLLGLVAGAIARFLVPGRDPMGWVGTIVLGIVGSFLG
FT                   GFLGYLIFGKDLNEGALQPSGIVGSIIGAIIVLLVYRAATHRRVLR"
     MVWTIIFWLL LGLVAGAIAR FLVPGRDPMG WVGTIVLGIV GSFLGGFLGY LIFGKDLNEG        60
     ALQPSGIVGS IIGAIIVLLV YRAATHRRVL R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page