(data stored in ACNUC7421 zone)

EMBL: CP002299.PE428

CP002299.PE428       Location/Qualifiers
FT   CDS             523514..524017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_45610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78516"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V4"
FT                   /inference="similar to AA sequence:KEGG:ROP_45610"
FT                   /protein_id="ADP78516.1"
FT                   /translation="MADIVDLVYADHDWLRRQFFYLDYATGNAELTAVWEALATRLDTH
FT                   ADAEETVFYPTLLKKGDSGDPEEETEDAIDDHNKIRAAVTDARSHRVGTKVWFEAVGAA
FT                   RTENGKHLDEEEREAIPDFIKSTSPELRHQLAMRWLQFYADHRDGAGVNTKSKDAAEYI
FT                   EANS"
     MADIVDLVYA DHDWLRRQFF YLDYATGNAE LTAVWEALAT RLDTHADAEE TVFYPTLLKK        60
     GDSGDPEEET EDAIDDHNKI RAAVTDARSH RVGTKVWFEA VGAARTENGK HLDEEEREAI       120
     PDFIKSTSPE LRHQLAMRWL QFYADHRDGA GVNTKSKDAA EYIEANS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page