(data stored in ACNUC7421 zone)

EMBL: CP002299.PE429

CP002299.PE429       Location/Qualifiers
FT   CDS             complement(524027..526348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0434"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="KEGG: fal:FRAAL1244 WD-40 repeat-containing
FT                   serine/threonin protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; WD40 repeat,
FT                   subgroup; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain; WD-40
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78517"
FT                   /db_xref="GOA:E3J9V5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78517.1"
FT                   /translation="MRGAPLRQGGDVSEVPAGVEPLDDFDPHQLGPYTLLGRLGHGGMG
FT                   TVYLGRRAAAETGAADPATGGNSVTEPATAGPLLAIKVIRPELATVAEFRERFAREARA
FT                   AQSVHNAYTAAVLDVNITGSRPYLVTEYVDGPTLSDRIRRNGPLPAAQLEWLAGAVADA
FT                   LRAIHAAGVIHRDLKPGNILLSPFGARVIDFGIARALDTTTMATQSAIGTPAFMAPEQV
FT                   LNEGVTSAVDIHAWGAVLVFAATGNAPFAGDTIPKVMRQVLEVTPDLTSLPGTLRPLAA
FT                   RALAKDPAARPTAAELGDAVRQIHTPPPTPTSEMSTYSPDRTATRAQPPVTGPPPTPRP
FT                   ASATASPPAPRPATHDGPRGDTGSSTGMSEAGTHLADPGPGRQAVPANVTDQDPGPWPR
FT                   PRRQRRRAVLAAGLAVVVVLAGAVTAFALQGSGGDGGGEPATSVSGTPSSSGNFRALGD
FT                   RLTDAKDQVWGVATTPDGSTLAAASQNGTVTLWDISRPAKPRALPSLSTGDTTGMMAAA
FT                   FAPGGRTLASGSRNGTVQLWDVSNPGAARRLGAPIVAAGGGPAWSVGFAPVGNLLASGD
FT                   GNGTVRVWNVSSPQAPVMAGQPFHFDGGQVWSVAFSPDGSILATAGQDGSVGLWDVSNP
FT                   QAQPQPLGTLPVQSGNGVKAVESLAFTPDGHTLITGSIDHAVRLWDITVPSVPRLLAAP
FT                   SQPNQVWAVALTLDGRVLATAGADRTIRFWDISDPTAPRPVGTPLTGHTDTITKLAFTP
FT                   DGHTLVSGSRDKTVRLWTSG"
     MRGAPLRQGG DVSEVPAGVE PLDDFDPHQL GPYTLLGRLG HGGMGTVYLG RRAAAETGAA        60
     DPATGGNSVT EPATAGPLLA IKVIRPELAT VAEFRERFAR EARAAQSVHN AYTAAVLDVN       120
     ITGSRPYLVT EYVDGPTLSD RIRRNGPLPA AQLEWLAGAV ADALRAIHAA GVIHRDLKPG       180
     NILLSPFGAR VIDFGIARAL DTTTMATQSA IGTPAFMAPE QVLNEGVTSA VDIHAWGAVL       240
     VFAATGNAPF AGDTIPKVMR QVLEVTPDLT SLPGTLRPLA ARALAKDPAA RPTAAELGDA       300
     VRQIHTPPPT PTSEMSTYSP DRTATRAQPP VTGPPPTPRP ASATASPPAP RPATHDGPRG       360
     DTGSSTGMSE AGTHLADPGP GRQAVPANVT DQDPGPWPRP RRQRRRAVLA AGLAVVVVLA       420
     GAVTAFALQG SGGDGGGEPA TSVSGTPSSS GNFRALGDRL TDAKDQVWGV ATTPDGSTLA       480
     AASQNGTVTL WDISRPAKPR ALPSLSTGDT TGMMAAAFAP GGRTLASGSR NGTVQLWDVS       540
     NPGAARRLGA PIVAAGGGPA WSVGFAPVGN LLASGDGNGT VRVWNVSSPQ APVMAGQPFH       600
     FDGGQVWSVA FSPDGSILAT AGQDGSVGLW DVSNPQAQPQ PLGTLPVQSG NGVKAVESLA       660
     FTPDGHTLIT GSIDHAVRLW DITVPSVPRL LAAPSQPNQV WAVALTLDGR VLATAGADRT       720
     IRFWDISDPT APRPVGTPLT GHTDTITKLA FTPDGHTLVS GSRDKTVRLW TSG              773
//

If you have problems or comments...

PBIL Back to PBIL home page