(data stored in ACNUC7421 zone)

EMBL: CP002299.PE430

CP002299.PE430       Location/Qualifiers
FT   CDS             526538..527125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0435"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: cai:Caci_0030 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78518"
FT                   /db_xref="GOA:E3J9V6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V6"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADP78518.1"
FT                   /translation="MDIEDDAFDDYFVARLPGLLRFAYLLTGDFGEAEDLTQTALARTF
FT                   RVWKRVRSHDRPDAYVRRVMVNANARRFRRRRPHQVLVAHPPDRPGRSPELGAVEDRAG
FT                   LVQALASLPQRQRAVVILRYCDDLAETEVAALLGCSVGTVKSQASKGLAKLRTHPALSD
FT                   LGPSSRALAAASGSTAPRLTDPRVTAIRREAQ"
     MDIEDDAFDD YFVARLPGLL RFAYLLTGDF GEAEDLTQTA LARTFRVWKR VRSHDRPDAY        60
     VRRVMVNANA RRFRRRRPHQ VLVAHPPDRP GRSPELGAVE DRAGLVQALA SLPQRQRAVV       120
     ILRYCDDLAE TEVAALLGCS VGTVKSQASK GLAKLRTHPA LSDLGPSSRA LAAASGSTAP       180
     RLTDPRVTAI RREAQ                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page