(data stored in ACNUC7421 zone)

EMBL: CP002299.PE434

CP002299.PE434       Location/Qualifiers
FT   CDS             complement(531147..532415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78522"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0787"
FT                   /protein_id="ADP78522.1"
FT                   /translation="MPDIPASAAPWPYHSQLPGRVVGEPAGRPIASSDAPAAHTRSDRR
FT                   KDLRSAANPSFRKPSGLSPDGVWVSLSGARPKGPRPDLKDGPQKVLLTRLNELNNPYRV
FT                   SYEMVSRQLWSDQAPTKIQRSRTRDLSRQLRGEKAIEWRVVEIYVDLLFPATDPLRASE
FT                   LIVLRDLHTQAFGTTVDPDGAPSPEPEAAPIDPAYVAELERQLEEARTRASFATALLVI
FT                   VQAENTTLRGRNSSFDWFHQPARAGSGRSAAEGGSRSRSGRRAATDQHASSSTNGRTTT
FT                   GRAGGTRSGAPNAAGTPSAPAASSTPRTGRREPGPNAEGEVFRSADPVTTPIVRRQGYR
FT                   AGQRRRPATTRATLADAFPTGPRAVVHPTTAPPAPASTLATPARGRSTSNSLHRAPTPD
FT                   PPADESGLDVLVSREKRRRGKNT"
     MPDIPASAAP WPYHSQLPGR VVGEPAGRPI ASSDAPAAHT RSDRRKDLRS AANPSFRKPS        60
     GLSPDGVWVS LSGARPKGPR PDLKDGPQKV LLTRLNELNN PYRVSYEMVS RQLWSDQAPT       120
     KIQRSRTRDL SRQLRGEKAI EWRVVEIYVD LLFPATDPLR ASELIVLRDL HTQAFGTTVD       180
     PDGAPSPEPE AAPIDPAYVA ELERQLEEAR TRASFATALL VIVQAENTTL RGRNSSFDWF       240
     HQPARAGSGR SAAEGGSRSR SGRRAATDQH ASSSTNGRTT TGRAGGTRSG APNAAGTPSA       300
     PAASSTPRTG RREPGPNAEG EVFRSADPVT TPIVRRQGYR AGQRRRPATT RATLADAFPT       360
     GPRAVVHPTT APPAPASTLA TPARGRSTSN SLHRAPTPDP PADESGLDVL VSREKRRRGK       420
     NT                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page