(data stored in ACNUC7421 zone)

EMBL: CP002299.PE435

CP002299.PE435       Location/Qualifiers
FT   CDS             complement(532966..533868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0440"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ara:Arad_2644
FT                   epoxide hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78523"
FT                   /db_xref="GOA:E3J9W1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78523.1"
FT                   /translation="MASGAERIQVRAGVLDVTLERSGSRDGRPVVLLHGFPYDARCYDE
FT                   VARLLAAEGADVVVPYLRGYGETRFTQASTPRSGQQAALAHDLLALIDVLGLESPLVAG
FT                   YDWGGRAACVVSALWPRRVGGLVTATGYNIQDIAASSTPRRPELERRLWYQYYLHGERG
FT                   VRGLAAYRSEFARQLWREWSPTWGFSETAFAASARSFDNPDFVDVVVHSYRHRYGLVAG
FT                   DPAYEPTEAALALQPPITVPTVVLDGEHDTVQPPKPRAAYEPHFPALVAHRVLNAGHNA
FT                   PQEAPADFARAITDLWAAL"
     MASGAERIQV RAGVLDVTLE RSGSRDGRPV VLLHGFPYDA RCYDEVARLL AAEGADVVVP        60
     YLRGYGETRF TQASTPRSGQ QAALAHDLLA LIDVLGLESP LVAGYDWGGR AACVVSALWP       120
     RRVGGLVTAT GYNIQDIAAS STPRRPELER RLWYQYYLHG ERGVRGLAAY RSEFARQLWR       180
     EWSPTWGFSE TAFAASARSF DNPDFVDVVV HSYRHRYGLV AGDPAYEPTE AALALQPPIT       240
     VPTVVLDGEH DTVQPPKPRA AYEPHFPALV AHRVLNAGHN APQEAPADFA RAITDLWAAL       300
//

If you have problems or comments...

PBIL Back to PBIL home page