(data stored in ACNUC7421 zone)

EMBL: CP002299.PE436

CP002299.PE436       Location/Qualifiers
FT   CDS             complement(533929..534882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0441"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: fal:FRAAL3189 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78524"
FT                   /db_xref="GOA:E3J9W2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADP78524.1"
FT                   /translation="MESRFELRYLAAFLAIAEELHFGRAAARLHMGQPSLSQQLQRLER
FT                   SVGVELVQRAPHQVKLTPAGRVFELEARRLLDQADRAVRVTREAASGRTGSISIGFNFP
FT                   AGQRILEPTLRRLNADYPRISTQLWEARSGPQLTALADGKLDVALAFAGPLAAALRSRR
FT                   LLTVPLVAVVGGRHPWVNRGQVAFRELAEQRCVLFRRHESPAMHDAILAAADLSGIRLT
FT                   IADEVDDSGATGLVVTTRDLVGFASTARGAALPTPGMAAVRLVDPVPTVGVYAVWRPDP
FT                   QPVVGAFLRSLDGAGPFSEQAQAAAPGSASPGMRPV"
     MESRFELRYL AAFLAIAEEL HFGRAAARLH MGQPSLSQQL QRLERSVGVE LVQRAPHQVK        60
     LTPAGRVFEL EARRLLDQAD RAVRVTREAA SGRTGSISIG FNFPAGQRIL EPTLRRLNAD       120
     YPRISTQLWE ARSGPQLTAL ADGKLDVALA FAGPLAAALR SRRLLTVPLV AVVGGRHPWV       180
     NRGQVAFREL AEQRCVLFRR HESPAMHDAI LAAADLSGIR LTIADEVDDS GATGLVVTTR       240
     DLVGFASTAR GAALPTPGMA AVRLVDPVPT VGVYAVWRPD PQPVVGAFLR SLDGAGPFSE       300
     QAQAAAPGSA SPGMRPV                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page